Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHTF2 Peptide - C-terminal region

PHTF2 Peptide - C-terminal region

Product Specifications

UniProt

B3KQZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHTF2 Rabbit Polyclonal Antibody (orb580759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTPFVFRLSQATDLEQLTAHSASELYVIAFGSNEDVIVLSMVIISFVVRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Recombinant Human BAFF trimer Protein, Avi His Tag
E40KMP1916 20 µg

Biotinylated Recombinant Human BAFF trimer Protein, Avi His Tag

Sign In for Pricing
View Details
Fabomotizole hydrochloride
C16863-25mg 25 mg

Fabomotizole hydrochloride

Sign In for Pricing
View Details
CaMKII alpha/CAMK2A Rabbit Polyclonal Antibody (APC)
orb2606563 100 µg

CaMKII alpha/CAMK2A Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Alexa Fluor® 700 anti-human CD69
E16FHI069-100U 100 µg

Alexa Fluor® 700 anti-human CD69

Sign In for Pricing
View Details
RFX6 Antibody, Biotin conjugated
A60998-100UG 100 µg

RFX6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CD55 (DAF, Decay Accelerating Factor) (MaxLight 490) discontinued
C2410-02-ML490 100 µL

CD55 (DAF, Decay Accelerating Factor) (MaxLight 490) discontinued

Sign In for Pricing
View Details