CWH43 Peptide - C-terminal region
CWH43 Peptide - C-terminal region
Product Specifications
UniProt
D6RDZ8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CWH43 Rabbit Polyclonal Antibody (orb580920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GMASRPNWLLAGAAFGSLVFLTHWVFGEVSLVSRWAVSGHPHPGPDPNPF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-C365000-10G 10 g
2-Chloro-4H-1,3,2-benzodioxaphosphorin-4-one (90%)
Sign In for Pricing
View Details 
BNUM2344-50 1x 50 µL
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), 1mg/mL
Sign In for Pricing
View Details 
![CSN7b Recombinant Rabbit Monoclonal Antibody [PSH06-84]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea8232f/imageurl/ha722758.webp)
HA722758 100 µL
CSN7b Recombinant Rabbit Monoclonal Antibody [PSH06-84]
Sign In for Pricing
View Details 
BNC880957-100 1x 100 µL
Histone H1 (HH1/957), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details