ZNF846 Peptide - N-terminal region
ZNF846 Peptide - N-terminal region
Product Specifications
UniProt
Q147U1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF846 Rabbit Polyclonal Antibody (orb325584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAFNQFPNL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1579-100 1x 100 µL
SREBP2 (SREBP2/1579), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682602-500 1x 500 µL
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details