Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF846 Peptide - N-terminal region

ZNF846 Peptide - N-terminal region

Product Specifications

UniProt

Q147U1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF846 Rabbit Polyclonal Antibody (orb325584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAFNQFPNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntenin Recombinant Rabbit Monoclonal Antibody [JE40-72]
ET7109-14 100 µL

Syntenin Recombinant Rabbit Monoclonal Antibody [JE40-72]

Sign In for Pricing
View Details
Biotin Conjugated Vicia graminea Lectin -VGA-
BA-4400-2 2 mL

Biotin Conjugated Vicia graminea Lectin -VGA-

Sign In for Pricing
View Details
CHPF (NM_024536) Human Over-expression Lysate
LY403000 100 µg

CHPF (NM_024536) Human Over-expression Lysate

Sign In for Pricing
View Details
PKC nu (PRKD3) Mouse Monoclonal Antibody [Clone ID: OTI4G6]
CF805724 100 µg

PKC nu (PRKD3) Mouse Monoclonal Antibody [Clone ID: OTI4G6]

Sign In for Pricing
View Details
Actbl2 Mouse Gene Knockout Kit (CRISPR)
KN500773 1 Kit

Actbl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Urethane-d5
TRC-U825302-50MG 50 mg

Urethane-d5

Sign In for Pricing
View Details