MBTD1 Peptide - N-terminal region
MBTD1 Peptide - N-terminal region
Product Specifications
UniProt
Q05BQ5
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MBTD1 Rabbit Polyclonal Antibody (orb581144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681541-100 1x 100 µL
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942427-100 1x 100 µL
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details