Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBTD1 Peptide - N-terminal region

MBTD1 Peptide - N-terminal region

Product Specifications

UniProt

Q05BQ5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MBTD1 Rabbit Polyclonal Antibody (orb581144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stam2 Mouse Gene Knockout Kit (CRISPR)
KN516828 1 Kit

Stam2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ACADVL activation kit by CRISPRa
GA100029 1 Kit

Human ACADVL activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Mre11
Y058496 100 µL

Anti-Mre11

Sign In for Pricing
View Details
ABI1 Polyclonal Antibody
E-AB-12222-01 20 µL

ABI1 Polyclonal Antibody

Sign In for Pricing
View Details
ABI1 Polyclonal Antibody
E-AB-12222-02 60 µL

ABI1 Polyclonal Antibody

Sign In for Pricing
View Details
ABI1 Polyclonal Antibody
E-AB-12222-03 120 µL

ABI1 Polyclonal Antibody

Sign In for Pricing
View Details