Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB41 Peptide - C-terminal region

ZBTB41 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FRBZ1, RP11-469L3.1, ZNF924

UniProt

Q5SVQ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBTB41 Rabbit Polyclonal Antibody (orb581239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919290

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVRHTTTLPPSSHEILSPQPQSTDYPRAADLAFLEKYTLTPQPANIVHPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAIP2 (NM_001033112) Human Over-expression Lysate
LC422367 20 µg

PAIP2 (NM_001033112) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Cytochrome P450 1B1 Antibody
RC-5129-01 50 μL

Recombinant Cytochrome P450 1B1 Antibody

Sign In for Pricing
View Details
Recombinant Cytochrome P450 1B1 Antibody
RC-5129-02 100 µL

Recombinant Cytochrome P450 1B1 Antibody

Sign In for Pricing
View Details
Recombinant Cytochrome P450 1B1 Antibody
RC-5129-03 1 mL

Recombinant Cytochrome P450 1B1 Antibody

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), 1mg/mL
BNUM2029-50 1x 50 µL

ARF1 (Golgi Apparatus Marker) (3F1), 1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), 0.2mg/mL
BNUB2452-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), 0.2mg/mL

Sign In for Pricing
View Details