ZBTB41 Peptide - C-terminal region
ZBTB41 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FRBZ1, RP11-469L3.1, ZNF924
UniProt
Q5SVQ8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZBTB41 Rabbit Polyclonal Antibody (orb581239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_919290
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVRHTTTLPPSSHEILSPQPQSTDYPRAADLAFLEKYTLTPQPANIVHPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM041164-01 10 µg
Recombinant Mouse CD30/TNFRSF8 Protein (His Tag)
Sign In for Pricing
View Details PKSM041164-02 50 µg
Recombinant Mouse CD30/TNFRSF8 Protein (His Tag)
Sign In for Pricing
View Details 
