Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF12 Peptide - N-terminal region

ZNF12 Peptide - N-terminal region

Product Specifications

UniProt

P17014

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF12 Rabbit Polyclonal Antibody (orb581268) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EWQQLDPEQKITYRDVMLENYSNLVSVGYHIIKPDVISKLEQGEEPWIVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GST, AlpHcAbs® Rabbit antibody (Biotin)
HA710106 100 µg

GST, AlpHcAbs® Rabbit antibody (Biotin)

Sign In for Pricing
View Details
SLC2A13 (NM_052885) Human Over-expression Lysate
LY432337 100 µg

SLC2A13 (NM_052885) Human Over-expression Lysate

Sign In for Pricing
View Details
Copper(II) Acetate Monohydrate
TRC-C685245-50G 50 g

Copper(II) Acetate Monohydrate

Sign In for Pricing
View Details
Fmoc-g-[Beta-(5-naphthyl Sulfonic Acid)-ethylenediamine]-L-glutamic Acid
TRC-F647500-250MG 250 mg

Fmoc-g-[Beta-(5-naphthyl Sulfonic Acid)-ethylenediamine]-L-glutamic Acid

Sign In for Pricing
View Details
MEIS2 Human Gene Knockout Kit (CRISPR)
KN401395 1 Kit

MEIS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GABRQ Polyclonal Antibody
E-AB-90615-01 60 µL

GABRQ Polyclonal Antibody

Sign In for Pricing
View Details