Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAS1 Peptide - N-terminal region

MAS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAS

UniProt

P04201

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAS1 Rabbit Polyclonal Antibody (orb581297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002368

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta-actin Mouse Monoclonal Antibody
MBS8500761-01 0.1 mg

beta-actin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
beta-actin Mouse Monoclonal Antibody
MBS8500761-02 0.1 mL (AF635)

beta-actin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
beta-actin Mouse Monoclonal Antibody
MBS8500761-03 0.1 mL (AF610)

beta-actin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
beta-actin Mouse Monoclonal Antibody
MBS8500761-04 0.1 mL (AF405S)

beta-actin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
beta-actin Mouse Monoclonal Antibody
MBS8500761-05 0.1 mL (AF405L)

beta-actin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
beta-actin Mouse Monoclonal Antibody
MBS8500761-06 0.1 mL (AF546)

beta-actin Mouse Monoclonal Antibody

Sign In for Pricing
View Details