Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAS1 Peptide - N-terminal region

MAS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAS

UniProt

P04201

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAS1 Rabbit Polyclonal Antibody (orb581297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002368

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slap (SLA) Rabbit Polyclonal Antibody
TA360217 100 µL

Slap (SLA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Cathepsin H Rabbit Monoclonal Antibody
1330-01 20 μL

Anti-Cathepsin H Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Cathepsin H Rabbit Monoclonal Antibody
1330-02 100 μL

Anti-Cathepsin H Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Fish Prostaglandin E2 Receptor EP2 Subtype (PTGER2) ELISA Kit
MBS9365151 Inquire

Fish Prostaglandin E2 Receptor EP2 Subtype (PTGER2) ELISA Kit

Sign In for Pricing
View Details
PEX12 (Center) Rabbit Polyclonal Antibody
AP53259PU-N 400 µL

PEX12 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Nucleoporin 214kDa (NUP214)
MBS2052088-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Nucleoporin 214kDa (NUP214)

Sign In for Pricing
View Details