Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ints12 Peptide - C-terminal region

Ints12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Phf22

UniProt

Q68FR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ints12 Rabbit Polyclonal Antibody (orb325661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007641

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGNGNSATAGPTGSITSKTTSETSSSTSASLKGPTSQESQLNAMKRLQMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-17RC shRNA (m) Lentiviral Particles
sc-146205-V 200 µL

IL-17RC shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)
MBS1151675-01 0.02 mg (E-Coli)

Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)
MBS1151675-02 0.02 mg (Yeast)

Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)
MBS1151675-03 0.1 mg (E-Coli)

Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)
MBS1151675-04 0.1 mg (Yeast)

Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)
MBS1151675-05 0.02 mg (Baculovirus)

Recombinant Gemmatimonas aurantiaca Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details