Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ints12 Peptide - C-terminal region

Ints12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Phf22

UniProt

Q68FR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ints12 Rabbit Polyclonal Antibody (orb325661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007641

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGNGNSATAGPTGSITSKTTSETSSSTSASLKGPTSQESQLNAMKRLQMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dimethachlor ethane sulfonic acid sodium salt-d6
HY-W714698 1 Each

Dimethachlor ethane sulfonic acid sodium salt-d6

Sign In for Pricing
View Details
IFI27L2 Antibody, HRP conjugated
A70166-100UG 100 µg

IFI27L2 Antibody, HRP conjugated

Sign In for Pricing
View Details
CHP2 siRNA (Human)
orb1856392-01 15 nmol

CHP2 siRNA (Human)

Sign In for Pricing
View Details
CHP2 siRNA (Human)
orb1856392-02 30 nmol

CHP2 siRNA (Human)

Sign In for Pricing
View Details
TREM-1 CRISPR/Cas9 KO Plasmid (m)
sc-425490 20 µg

TREM-1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Ggt1, NT (Ggt1, Ggt, Gamma-glutamyltranspeptidase 1, Gamma-glutamyltransferase 1, Glutathione hydrolase 1, Leukotriene-C4 hydrolase, CD224, Gamma-glutamyltranspeptidase 1 heavy chain, Gamma-glutamyltranspeptidase 1 light chain) (APC) discontinued
036023-APC 200 µL

Ggt1, NT (Ggt1, Ggt, Gamma-glutamyltranspeptidase 1, Gamma-glutamyltransferase 1, Glutathione hydrolase 1, Leukotriene-C4 hydrolase, CD224, Gamma-glutamyltranspeptidase 1 heavy chain, Gamma-glutamyltranspeptidase 1 light chain) (APC) discontinued

Sign In for Pricing
View Details