Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF526 Peptide - N-terminal region

ZNF526 Peptide - N-terminal region

Product Specifications

UniProt

H9ZYJ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF526 Rabbit Polyclonal Antibody (orb581406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597701

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPPSPPSEVKMEPYECPECSTLCATPEEFLEHQGTHFDSLEKEERNGLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RUBCN Protein, N-His
orb2832766-01 20 µg

Recombinant Human RUBCN Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RUBCN Protein, N-His
orb2832766-02 50 µg

Recombinant Human RUBCN Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RUBCN Protein, N-His
orb2832766-03 100 µg

Recombinant Human RUBCN Protein, N-His

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Left/Right Determination Factor 1 (LEFTY1)
MBS2063790-01 0.1 mL

HRP-Linked Polyclonal Antibody to Left/Right Determination Factor 1 (LEFTY1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Left/Right Determination Factor 1 (LEFTY1)
MBS2063790-02 0.2 mL

HRP-Linked Polyclonal Antibody to Left/Right Determination Factor 1 (LEFTY1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Left/Right Determination Factor 1 (LEFTY1)
MBS2063790-03 0.5 mL

HRP-Linked Polyclonal Antibody to Left/Right Determination Factor 1 (LEFTY1)

Sign In for Pricing
View Details