ZNF526 Peptide - N-terminal region
ZNF526 Peptide - N-terminal region
Product Specifications
UniProt
H9ZYJ3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF526 Rabbit Polyclonal Antibody (orb581406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_597701
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPPSPPSEVKMEPYECPECSTLCATPEEFLEHQGTHFDSLEKEERNGLEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2160893-01 96 Tests
IL2 Inducible T-Cell Kinase (ITK) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details MBS2160893-02 5x 96 Tests
IL2 Inducible T-Cell Kinase (ITK) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details MBS2160893-03 10x 96 Tests
IL2 Inducible T-Cell Kinase (ITK) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details 
P04-29510S1 500 mL
William´s Medium E, w: stable Glutamine, w/o: Phenol red, w: 2.24 g/L NaHCO3
Sign In for Pricing
View Details 