Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC6L2 Peptide - N-terminal region

ERCC6L2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BMFS2, SR278, RAD26L, C9orf102

UniProt

Q5T890

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC6L2 Rabbit Polyclonal Antibody (orb582321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRELATGRKAMQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NG2 Rabbit Polyclonal Antibody (APC)
orb1000069 100 µL

NG2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
FOXM1 Rabbit Polyclonal Antibody (Biotin)
orb1595913 100 µL

FOXM1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
UFL1 (NM_015323) Human Over-expression Lysate
LS023376 100 µg

UFL1 (NM_015323) Human Over-expression Lysate

Sign In for Pricing
View Details
VSIG2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV649584 1.0 µg DNA

VSIG2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Autophagy-related protein 17 (atg17)
MBS1096493-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Autophagy-related protein 17 (atg17)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Autophagy-related protein 17 (atg17)
MBS1096493-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Autophagy-related protein 17 (atg17)

Sign In for Pricing
View Details