Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC6L2 Peptide - N-terminal region

ERCC6L2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BMFS2, SR278, RAD26L, C9orf102

UniProt

Q5T890

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC6L2 Rabbit Polyclonal Antibody (orb582321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRELATGRKAMQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GRP75 Antibody
CPA1556-01 30 µL

Anti-GRP75 Antibody

Sign In for Pricing
View Details
Anti-GRP75 Antibody
CPA1556-02 50 μL

Anti-GRP75 Antibody

Sign In for Pricing
View Details
Anti-GRP75 Antibody
CPA1556-03 100 µL

Anti-GRP75 Antibody

Sign In for Pricing
View Details
Anti-GRP75 Antibody
CPA1556-04 200 µL

Anti-GRP75 Antibody

Sign In for Pricing
View Details
Olr1202 (NM_001000817) Rat Tagged ORF Clone Lentiviral Particle
RR203293L4V 200 µL

Olr1202 (NM_001000817) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PAK4 Protein Lysate (Human) with C-Ha Tag
35962031 100 µg

PAK4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details