Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMD2 Peptide - N-terminal region

MMD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAQR10

UniProt

Q8IY49

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMD2 Rabbit Polyclonal Antibody (orb582376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940685

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Coiled coil domain containing protein 136 (CCDC136) ELISA Kit
GTR10312781 96 Well

Porcine Coiled coil domain containing protein 136 (CCDC136) ELISA Kit

Sign In for Pricing
View Details
Cacnb4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6907908 1.0 µg DNA

Cacnb4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ApoA4 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-2688R-BF350-TR 20 µL

ApoA4 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
ZNRF4 Protein Vector (Mouse) (pPM-C-His)
PV251017 500 ng

ZNRF4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Dclk3-set siRNA/shRNA/RNAi Lentivector (Mouse)
17732094 4x 500 ng

Dclk3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Cdyl2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7554403 1.0 µg DNA

Cdyl2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details