ORC6 Peptide - N-terminal region
ORC6 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ORC6L
UniProt
Q9Y5N6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ORC6 Rabbit Polyclonal Antibody (orb582591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055136
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![1-[2-Hydroxy-4, 6-bis[ (2-methoxyethoxy) methoxy]phenyl]-3-[3-methoxy-4-[ (2-methoxyethoxy) methoxy]phenyl]-2-propen-1-one](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
408600-01 5 mg
1-[2-Hydroxy-4, 6-bis[ (2-methoxyethoxy) methoxy]phenyl]-3-[3-methoxy-4-[ (2-methoxyethoxy) methoxy]phenyl]-2-propen-1-one
Sign In for Pricing
View Details 408600-02 10 mg
1-[2-Hydroxy-4, 6-bis[ (2-methoxyethoxy) methoxy]phenyl]-3-[3-methoxy-4-[ (2-methoxyethoxy) methoxy]phenyl]-2-propen-1-one
Sign In for Pricing
View Details 
127731 50 µg
HAUS8 (HICE1, HAUS Augmin-like Complex Subunit 8, HEC1/NDC80-interacting Centrosome-associated Protein 1, Sarcoma Antigen NY-SAR-48, MGC20533)
Sign In for Pricing
View Details NBP2-70937AF647 0.1 mL
Mouse Monoclonal HES-1 Antibody (OTI4H1) [Alexa Fluor 647]
Sign In for Pricing
View Details