KANK1 Peptide - C-terminal region
KANK1 Peptide - C-terminal region
Product Specifications
UniProt
Q5W0W3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KANK1 Rabbit Polyclonal Antibody (orb582805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN209151 1 Kit
Dystrophia myotonica protein kinase (DMPK) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
AAF-421-1 1 mL
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Cat IgG Antibody
Sign In for Pricing
View Details