Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD226 Peptide - C-terminal region

CD226 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNAM-1, DNAM1, PTA1, TLiSA1

UniProt

Q15762

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD226 Rabbit Polyclonal Antibody (orb585752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006557

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX8 (Renal Cell Marker) (PAX8/1491), 0.2mg/mL
BNUB1491-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/1491), 0.2mg/mL

Sign In for Pricing
View Details
Staufen (STAU1) Rabbit Polyclonal Antibody
TA385342 100 µL

Staufen (STAU1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CBLN2 (C-term) Rabbit Polyclonal Antibody
AP50743PU-N 400 µL

CBLN2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Apg12 (ATG12) (NM_004707) Human Over-expression Lysate
LY401486 100 µg

Apg12 (ATG12) (NM_004707) Human Over-expression Lysate

Sign In for Pricing
View Details
Hieff Trans™ Universal Transfection Reagent
40808ES02 0.5 mL

Hieff Trans™ Universal Transfection Reagent

Sign In for Pricing
View Details
KLKBL4 (PRSS54) (NM_001080492) Human Over-expression Lysate
LC421047 20 µg

KLKBL4 (PRSS54) (NM_001080492) Human Over-expression Lysate

Sign In for Pricing
View Details