Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD226 Peptide - C-terminal region

CD226 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNAM-1, DNAM1, PTA1, TLiSA1

UniProt

Q15762

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD226 Rabbit Polyclonal Antibody (orb585752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006557

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Bcl-2 (B-cell Lymphoma/Leukemia 2) ELISA Kit
E-EL-R0096-01 24 Tests

Rat Bcl-2 (B-cell Lymphoma/Leukemia 2) ELISA Kit

Sign In for Pricing
View Details
Rat Bcl-2 (B-cell Lymphoma/Leukemia 2) ELISA Kit
E-EL-R0096-02 48 Tests

Rat Bcl-2 (B-cell Lymphoma/Leukemia 2) ELISA Kit

Sign In for Pricing
View Details
Rat Bcl-2 (B-cell Lymphoma/Leukemia 2) ELISA Kit
E-EL-R0096-03 96 Tests

Rat Bcl-2 (B-cell Lymphoma/Leukemia 2) ELISA Kit

Sign In for Pricing
View Details
Lewis A (7LE), CF647 conjugate, 0.1mg/mL
BNC470311-100 1x 100 µL

Lewis A (7LE), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF568 conjugate, 0.1mg/mL
BNC682043-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), 1mg/mL
BNUM2460-50 1x 50 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), 1mg/mL

Sign In for Pricing
View Details