Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCLAF3 Peptide - C-terminal region

BCLAF3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CXorf23

UniProt

A2AJT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCLAF3 Rabbit Polyclonal Antibody (orb587349) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_938020.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FHIASAAERDDQNSSFSKNYTTQRKDIITHKPFEVEGNHRNTRVRPFKSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR5A2 Mouse Monoclonal Antibody [Clone ID: OTI3H8]
CF805074 100 µg

NR5A2 Mouse Monoclonal Antibody [Clone ID: OTI3H8]

Sign In for Pricing
View Details
GLR
523342-01 100 µL

GLR

Sign In for Pricing
View Details
GLR
523342-02 200 µL

GLR

Sign In for Pricing
View Details
Urdamycin A
T36477 1 mg

Urdamycin A

Sign In for Pricing
View Details
His tag Antibody
E312205 200 µL

His tag Antibody

Sign In for Pricing
View Details
EIF2B2 (Translation Initiation Factor eIF-2B Subunit beta, S20I15, S20III15, eIF-2B GDP-GTP Exchange Factor Subunit beta, EIF2BB) (HRP)
126225-HRP 100 µL

EIF2B2 (Translation Initiation Factor eIF-2B Subunit beta, S20I15, S20III15, eIF-2B GDP-GTP Exchange Factor Subunit beta, EIF2BB) (HRP)

Sign In for Pricing
View Details