Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDLRAD2 Peptide - middle region

LDLRAD2 Peptide - middle region

Product Specifications

UniProt

Q5SZI1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LDLRAD2 Rabbit Polyclonal Antibody (orb587512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013715

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCGLNIPVPVASSGPFLGLRLVTRGRQPRVDFVGEVTSFRLGPCGAYFRC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAG3 antibody - N-terminal region
MBS3216270-01 0.1 mL

PRKAG3 antibody - N-terminal region

Sign In for Pricing
View Details
PRKAG3 antibody - N-terminal region
MBS3216270-02 5x 0.1 mL

PRKAG3 antibody - N-terminal region

Sign In for Pricing
View Details
Compound NP-015880
MBS5794560 Inquire

Compound NP-015880

Sign In for Pricing
View Details
Sox-6 shRNA (h) Lentiviral Particles
sc-36531-V 200 µL

Sox-6 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Bovine Thrombin Activatable Fibrinolysis Inhibitor ELISA kit
GTR10387478 96 Well

Bovine Thrombin Activatable Fibrinolysis Inhibitor ELISA kit

Sign In for Pricing
View Details
ADP-Ribosylation Factor 5 (ARF5) Antibody Pair
abx117368 5x 96 Tests

ADP-Ribosylation Factor 5 (ARF5) Antibody Pair

Sign In for Pricing
View Details