Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDLRAD2 Peptide - middle region

LDLRAD2 Peptide - middle region

Product Specifications

UniProt

Q5SZI1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LDLRAD2 Rabbit Polyclonal Antibody (orb587512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013715

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCGLNIPVPVASSGPFLGLRLVTRGRQPRVDFVGEVTSFRLGPCGAYFRC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Cytoplasmic dynein 2 heavy chain 1 (DYNC2H1) ELISA Kit
MBS7207894-01 48 Well

Canine Cytoplasmic dynein 2 heavy chain 1 (DYNC2H1) ELISA Kit

Sign In for Pricing
View Details
Canine Cytoplasmic dynein 2 heavy chain 1 (DYNC2H1) ELISA Kit
MBS7207894-02 96 Well

Canine Cytoplasmic dynein 2 heavy chain 1 (DYNC2H1) ELISA Kit

Sign In for Pricing
View Details
Canine Cytoplasmic dynein 2 heavy chain 1 (DYNC2H1) ELISA Kit
MBS7207894-03 5x 96 Well

Canine Cytoplasmic dynein 2 heavy chain 1 (DYNC2H1) ELISA Kit

Sign In for Pricing
View Details
Canine Cytoplasmic dynein 2 heavy chain 1 (DYNC2H1) ELISA Kit
MBS7207894-04 10x 96 Well

Canine Cytoplasmic dynein 2 heavy chain 1 (DYNC2H1) ELISA Kit

Sign In for Pricing
View Details
C-Myc (9E10) AC
sc-40 AC 500 µg/mL - 25% ag

C-Myc (9E10) AC

Sign In for Pricing
View Details
Mouse Neuromedin-S (NMS) ELISA kit
EIA06919m 96 Well

Mouse Neuromedin-S (NMS) ELISA kit

Sign In for Pricing
View Details