Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUMO2, Human (His)

Small ubiquitin-related modifier 2 (SUMO2) is a ubiquitin-like protein that covalently attached to proteins as part of post-translational modification system. SUMO2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, DNA replication and repair, mitosis, signal transduction and protein stability. SUMO2 Protein, Human (His) is the recombinant human-derived SUMO2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SUMO2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sumo2-protein-human-his.html

Purity

98.0

Smiles

MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Molecular Formula

6613 (Gene_ID) AAH08450.1 (M1-G93) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CYP2D6 Antibody
MBS7131793-01 0.1 mL

CYP2D6 Antibody

Ask
View Details
CYP2D6 Antibody
MBS7131793-02 5x 0.1 mL

CYP2D6 Antibody

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type S (PTPRS)
MBS2053598-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type S (PTPRS)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type S (PTPRS)
MBS2053598-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type S (PTPRS)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type S (PTPRS)
MBS2053598-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type S (PTPRS)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type S (PTPRS)
MBS2053598-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type S (PTPRS)

Ask
View Details