Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRC3 Peptide - C-terminal region

DRC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRRC48

UniProt

Q9H069

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DRC3 Rabbit Polyclonal Antibody (orb55736) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123562.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf28 Antibody
GWB-MM424A 50 µg

C2orf28 Antibody

Sign In for Pricing
View Details
Anti-Tau Rabbit Monoclonal Antibody
MBS179099-01 0.03 mL

Anti-Tau Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Tau Rabbit Monoclonal Antibody
MBS179099-02 0.1 mL

Anti-Tau Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Tau Rabbit Monoclonal Antibody
MBS179099-03 5x 0.1 mL

Anti-Tau Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
2- (4-chloro-2-butenyl) -1,3-isoindolinedione
OR26718 1 Each

2- (4-chloro-2-butenyl) -1,3-isoindolinedione

Sign In for Pricing
View Details
IL9 Rabbit anti-Human Polyclonal (aa19-144) Antibody
MBS2402992-01 0.05 mL

IL9 Rabbit anti-Human Polyclonal (aa19-144) Antibody

Sign In for Pricing
View Details