DRC3 Peptide - C-terminal region
DRC3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
LRRC48
UniProt
Q9H069
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DRC3 Rabbit Polyclonal Antibody (orb55736) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001123562.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
041338 200 µL
RUTBC1, CT (SGSM2, KIAA0397, RUTBC1, Small G protein signaling modulator 2, RUN and TBC1 domain-containing protein 1)
Sign In for Pricing
View Details 
I8426-15-PE 100 µL
Interleukin 4 (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) (PE)
Sign In for Pricing
View Details