MAPK1IP1L Peptide - N-terminal region
MAPK1IP1L Peptide - N-terminal region
Product Specifications
Product Name Alternative
C14orf32, MISS, c14_5346
UniProt
Q8NDC0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAPK1IP1L Rabbit Polyclonal Antibody (orb587531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_653179
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![HES6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H10]](https://cdn.genprice.uk/products/937/6868c39f994c49e6dc3fad46/imageurl/ta800749bm.webp)
TA800749BM 100 µL
HES6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H10]
Sign In for Pricing
View Details 
BNC400777-500 1x 500 µL
Chromogranin A (CHGA/777), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![4-[4-[2-(2-Pyridinyloxy)propoxy]phenoxy]phenol](https://cdn.genprice.uk/products/572/2859337145717/imageurl/trc-p840590-10mg.webp)
TRC-P840590-10MG 10 mg
4-[4-[2-(2-Pyridinyloxy)propoxy]phenoxy]phenol
Sign In for Pricing
View Details 
