MAPK1IP1L Peptide - N-terminal region
MAPK1IP1L Peptide - N-terminal region
Product Specifications
Product Name Alternative
C14orf32, MISS, c14_5346
UniProt
Q8NDC0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAPK1IP1L Rabbit Polyclonal Antibody (orb587531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_653179
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP02443PU-N 100 µL
MEK1 (MAP2K1) pSer222 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
E-UNEL-H0056-01 5x 96 Tests
Uncoated Human LDL (Low Density Lipoprotein) ELISA Kit
Sign In for Pricing
View Details