Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFR1 Peptide - N-terminal region

SFR1 Peptide - N-terminal region

Product Specifications

UniProt

Q86XK3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFR1 Rabbit Polyclonal Antibody (orb327028) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI3E9]
CF804221 100 µg

SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI3E9]

Sign In for Pricing
View Details
CAMK2B Mouse Monoclonal Antibody [Clone ID: OTI4G5]
CF808359 100 µg

CAMK2B Mouse Monoclonal Antibody [Clone ID: OTI4G5]

Sign In for Pricing
View Details
D-Glucosamine 6-Sulfate
TRC-G523013-5MG 5 mg

D-Glucosamine 6-Sulfate

Sign In for Pricing
View Details
Selenosulfuric Acid Dipotassium Salt, Technical Grade
TRC-S252500-50MG 50 mg

Selenosulfuric Acid Dipotassium Salt, Technical Grade

Sign In for Pricing
View Details
CD55 (NM_001114752) Human Over-expression Lysate
LY426508 100 µg

CD55 (NM_001114752) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR559276 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details