SFR1 Peptide - N-terminal region
SFR1 Peptide - N-terminal region
Product Specifications
UniProt
Q86XK3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SFR1 Rabbit Polyclonal Antibody (orb327028) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPAS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Purified Anti-Streptavidin Antibody[15E6]](https://cdn.genprice.uk/products/763/68dd14c4061270361e7d720c/imageurl08/an004140p.webp)
