Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTSS1L Peptide - middle region

MTSS1L Peptide - middle region

Product Specifications

UniProt

Q765P7

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTSS1L Rabbit Polyclonal Antibody (orb587550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKGKGDLQPQLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Separase Protein - (Dry Ice)
H00009700-Q01-25ug 25 µg

Recombinant Human Separase Protein - (Dry Ice)

Sign In for Pricing
View Details
Vmn1r184 Recombinant Protein (Mouse)
RP184061 100 µg

Vmn1r184 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Fluorene [CAS:86-73-7] 100 ug/ml in Acetonitrile
P826290 1 mL

Fluorene [CAS:86-73-7] 100 ug/ml in Acetonitrile

Sign In for Pricing
View Details
β Enolase (m) -PR
sc-37044-PR 10 µM - 20 µL

β Enolase (m) -PR

Sign In for Pricing
View Details
UppP Antibody
orb834347 2 mg

UppP Antibody

Sign In for Pricing
View Details
Mouse Monoclonal PKC alpha Antibody (MC5) [DyLight 405]
NB600-201V 0.1 mL

Mouse Monoclonal PKC alpha Antibody (MC5) [DyLight 405]

Sign In for Pricing
View Details