Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4X2 Peptide - N-terminal region

OR4X2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OR11-105

UniProt

Q8NGF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4X2 Rabbit Polyclonal Antibody (orb587602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004727

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd55 Hamster Monoclonal Antibody [Clone ID: RIKO-3]
AM31864PU-N 250 µg

Cd55 Hamster Monoclonal Antibody [Clone ID: RIKO-3]

Sign In for Pricing
View Details
Agpat1 Mouse Gene Knockout Kit (CRISPR)
KN500985 1 Kit

Agpat1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
POLR2A Mouse Monoclonal Antibody [Clone ID: OTI3C8]
CF810050 100 µg

POLR2A Mouse Monoclonal Antibody [Clone ID: OTI3C8]

Sign In for Pricing
View Details
PRMT4 (CARM1) Human Gene Knockout Kit (CRISPR)
KN217483BN 1 Kit

PRMT4 (CARM1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSMB8 Rabbit Monoclonal Antibody
TA423618 100 µL

PSMB8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Muffle Box Furnace BFMF-1200-20
BFMF-1200-20 1 Unit

Muffle Box Furnace BFMF-1200-20

Sign In for Pricing
View Details