Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4X2 Peptide - N-terminal region

OR4X2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OR11-105

UniProt

Q8NGF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4X2 Rabbit Polyclonal Antibody (orb587602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004727

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta 2 Adrenergic Receptor Recombinant Rabbit monoclonal Antibody
HA750368 100 µL

Beta 2 Adrenergic Receptor Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Platinum chloride
TRC-P578100-250MG 250 mg

Platinum chloride

Sign In for Pricing
View Details
FGF1 (NM_000800) Human Recombinant Protein
TP720040L 500 µg

FGF1 (NM_000800) Human Recombinant Protein

Sign In for Pricing
View Details
N4-Acetyldeoxycytidine
TRC-A164578-500MG 500 mg

N4-Acetyldeoxycytidine

Sign In for Pricing
View Details
Rps9 Mouse Gene Knockout Kit (CRISPR)
KN515119 1 Kit

Rps9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dylight 649 Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-
DY649-4601-1 1 mg

Dylight 649 Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-

Sign In for Pricing
View Details