AXIN2 Peptide - C-terminal region
AXIN2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AXIN2
UniProt
Q9Y2T1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AXIN2 Rabbit Polyclonal Antibody (orb574044) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004646
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PerCP/Cyanine5.5 Anti-Human HLA-DQ Antibody[1a3]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d3ffc/imageurl08/an00421j.webp)
AN00421J-01 20 Tests
PerCP/Cyanine5.5 Anti-Human HLA-DQ Antibody[1a3]
Sign In for Pricing
View Details AN00421J-02 100 Tests
PerCP/Cyanine5.5 Anti-Human HLA-DQ Antibody[1a3]
Sign In for Pricing
View Details AN00421J-03 2x 100 Tests
PerCP/Cyanine5.5 Anti-Human HLA-DQ Antibody[1a3]
Sign In for Pricing
View Details 
LY432805 100 µg
CLM 9 (CD300LG) (NM_001168323) Human Over-expression Lysate
Sign In for Pricing
View Details 