Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AXIN2 Peptide - C-terminal region

AXIN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AXIN2

UniProt

Q9Y2T1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AXIN2 Rabbit Polyclonal Antibody (orb574044) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004646

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDIT4L Human Gene Knockout Kit (CRISPR)
KN402324 1 Kit

DDIT4L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF405S conjugate, 0.1mg/mL
BNC042337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ugt2a2 Mouse Gene Knockout Kit (CRISPR)
KN518672 1 Kit

Ugt2a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-[4-(5-Fluoro-1,2-benzisoxazol-3-yl)-1-piperidinyl]ethanone
TRC-F588585-50MG 50 mg

1-[4-(5-Fluoro-1,2-benzisoxazol-3-yl)-1-piperidinyl]ethanone

Sign In for Pricing
View Details
Human IL-33 Antibody Pair Set
E-KAB-0203 50 µL & 100 µg

Human IL-33 Antibody Pair Set

Sign In for Pricing
View Details
Racked ultra low retention tip 96x10 BPIC-426
BPIC-426 1 Unit

Racked ultra low retention tip 96x10 BPIC-426

Sign In for Pricing
View Details