ZSCAN29 Peptide - C-terminal region
ZSCAN29 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZNF690, Zfp690
UniProt
Q8IWY8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZSCAN29 Rabbit Polyclonal Antibody (orb324631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_006720464
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSEAEAQKQAEEADEATEEDSDDDEEDTEIPPGAVITRAPVLFQSPRGFE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1860-100 1x 100 µL
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TA423929 100 µL
Retinoid X Receptor alpha (RXRA) Rabbit Monoclonal Antibody
Sign In for Pricing
View Details 
RD-EPHA3-Hu-01 96 Tests
Human Ephrin Type A Receptor 3 (EPHA3) ELISA Kit
Sign In for Pricing
View Details RD-EPHA3-Hu-02 48 Tests
Human Ephrin Type A Receptor 3 (EPHA3) ELISA Kit
Sign In for Pricing
View Details