Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN29 Peptide - C-terminal region

ZSCAN29 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZSCAN29 Rabbit Polyclonal Antibody (orb324631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006720464

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSEAEAQKQAEEADEATEEDSDDDEEDTEIPPGAVITRAPVLFQSPRGFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAG (PAG1) Human Gene Knockout Kit (CRISPR)
KN419183 1 Kit

PAG (PAG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MED28 Mouse Monoclonal Antibody [Clone ID: OTI10C8]
CF810134 100 µg

MED28 Mouse Monoclonal Antibody [Clone ID: OTI10C8]

Sign In for Pricing
View Details
Acrylic Acid (stabilized with MEHQ)
TRC-A191350-5G 5 g

Acrylic Acid (stabilized with MEHQ)

Sign In for Pricing
View Details
Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)
PKSQ050037-01 10 µg

Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)

Sign In for Pricing
View Details
Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)
PKSQ050037-02 50 µg

Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)

Sign In for Pricing
View Details
N6-[(Benzylamino)carbonothioyl]lysine-13C6,15N2
TRC-B410967-1MG 1 mg

N6-[(Benzylamino)carbonothioyl]lysine-13C6,15N2

Sign In for Pricing
View Details