Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF461 Peptide - C-terminal region

ZNF461 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GIOT1, HZF28, GIOT-1

UniProt

Q8TAF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF461 Rabbit Polyclonal Antibody (orb324826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V5 epitope tag Antibody [SV5-P-K], Human IgG1
24-158 0.2 mg

V5 epitope tag Antibody [SV5-P-K], Human IgG1

Sign In for Pricing
View Details
Anti-PROM1/CD133 Antibody Picoband® (monoclonal, 8B6), Dylight594 Conjugate
M01767-3-Dylight594 100 µg

Anti-PROM1/CD133 Antibody Picoband® (monoclonal, 8B6), Dylight594 Conjugate

Sign In for Pricing
View Details
Anti-Human CSPG4/HMW-MAA/MCSP/NG2 Antibody (IND-2), PE
HV349427-01 1 Each

Anti-Human CSPG4/HMW-MAA/MCSP/NG2 Antibody (IND-2), PE

Sign In for Pricing
View Details
Anti-Human CSPG4/HMW-MAA/MCSP/NG2 Antibody (IND-2), PE
HV349427-02 100 Tests

Anti-Human CSPG4/HMW-MAA/MCSP/NG2 Antibody (IND-2), PE

Sign In for Pricing
View Details
Rabbit Anti-GMPR1 antibody
SL13462R-01 50 µL

Rabbit Anti-GMPR1 antibody

Sign In for Pricing
View Details
Rabbit Anti-GMPR1 antibody
SL13462R-02 100 µL

Rabbit Anti-GMPR1 antibody

Sign In for Pricing
View Details