Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGCR Peptide - C-terminal region

HMGCR Peptide - C-terminal region

Product Specifications

Product Name Alternative

HMGCR

UniProt

P04035

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMGCR Rabbit Polyclonal Antibody (orb325142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KA1 Protein Vector (Human) (pPM-C-HA)
42590021 500 ng

RPS6KA1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
FAM50A Protein Vector (Rat) (pPM-C-His)
PV267569 500 ng

FAM50A Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Rat Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-alpha ELISA Kit
MBS3807954-01 48 Well

Rat Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-alpha ELISA Kit

Sign In for Pricing
View Details
Rat Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-alpha ELISA Kit
MBS3807954-02 96 Well

Rat Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-alpha ELISA Kit

Sign In for Pricing
View Details
Rat Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-alpha ELISA Kit
MBS3807954-03 5x 96 Well

Rat Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-alpha ELISA Kit

Sign In for Pricing
View Details
Rat Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-alpha ELISA Kit
MBS3807954-04 10x 96 Well

Rat Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-alpha ELISA Kit

Sign In for Pricing
View Details