HS6ST2 Peptide - N-terminal region
HS6ST2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
PSEC0092
UniProt
Q96MM7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HS6ST2 Rabbit Polyclonal Antibody (orb325198) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESSARFVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: 3G8]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbe71/imageurl/am06606su-n.webp)
AM06606SU-N 100 µL
Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: 3G8]
Sign In for Pricing
View Details 
