Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HS6ST2 Peptide - N-terminal region

HS6ST2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSEC0092

UniProt

Q96MM7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HS6ST2 Rabbit Polyclonal Antibody (orb325198) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESSARFVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1S,3R)-Inpyrfluxam-hydroxy
TRC-I618390-25MG 25 mg

(1S,3R)-Inpyrfluxam-hydroxy

Sign In for Pricing
View Details
Mouse Eef1a1 activation kit by CRISPRa
GA201185 1 Kit

Mouse Eef1a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mini glass tubes
#22019 1x 100 Each

Mini glass tubes

Sign In for Pricing
View Details
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-100 1x 100 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MYCN Polyclonal Antibody
E-AB-13462-01 20 µL

MYCN Polyclonal Antibody

Sign In for Pricing
View Details
MYCN Polyclonal Antibody
E-AB-13462-02 60 µL

MYCN Polyclonal Antibody

Sign In for Pricing
View Details