NUSAP1 Peptide - middle region
NUSAP1 Peptide - middle region
Product Specifications
Product Name Alternative
LNP, ANKT, SAPL, BM037, NUSAP, Q0310, PRO0310p1
UniProt
Q9BXS6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NUSAP1 Rabbit Polyclonal Antibody (orb579729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HFEEHNSMNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15148506 1 Vial
Lentiviral mouse Hmces shRNA (UAS) - Lentiviral mouse Hmces shRNA (UAS) (100)
Sign In for Pricing
View Details 