Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARS Peptide - C-terminal region

TARS Peptide - C-terminal region

Product Specifications

Product Name Alternative

ThrRS

UniProt

P26639

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TARS Rabbit Polyclonal Antibody (orb325268) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689508

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENOX1 (NM_017993) Human Over-expression Lysate
LY402636 100 µg

ENOX1 (NM_017993) Human Over-expression Lysate

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2858R), CF740 conjugate, 0.1mg/mL
BNC742858-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2858R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lithium Perchlorate
TRC-L469270-5G 5 g

Lithium Perchlorate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS503709 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
FITC Conjugated Canavalia ensiformis Lectin (Jackbean) -Con A-
F-1104-2 2 mg

FITC Conjugated Canavalia ensiformis Lectin (Jackbean) -Con A-

Sign In for Pricing
View Details
2-Bromoisophthaldehyde
TRC-B685885-25G 25 g

2-Bromoisophthaldehyde

Sign In for Pricing
View Details