TARS Peptide - C-terminal region
TARS Peptide - C-terminal region
Product Specifications
Product Name Alternative
ThrRS
UniProt
P26639
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TARS Rabbit Polyclonal Antibody (orb325268) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689508
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![BAG5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E5]](https://cdn.genprice.uk/products/937/68dd1b86061270361ea209db/imageurl/ta811740bm.webp)
TA811740BM 100 µL
BAG5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E5]
Sign In for Pricing
View Details 
TRC-D496485-10MG 10 mg
7,8-Dihydroxy-3-(4-hydroxy-phenyl)-chromen-4-one
Sign In for Pricing
View Details 
LY400354 100 µg
Retinoic Acid Receptor gamma (RARG) (NM_000966) Human Over-expression Lysate
Sign In for Pricing
View Details 
TP323670M 100 µg
METTL21D (VCPKMT) (NM_024558) Human Recombinant Protein
Sign In for Pricing
View Details 
