Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF256 Peptide - N-terminal region

ZNF256 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BMZF3, BMZF-3

UniProt

Q9Y2P7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF256 Rabbit Polyclonal Antibody (orb325356) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLQQQAAHTRKKSNRTKSAVAFHSVKNHYNWGECVKAFSYKHVRVQHQGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]
E-AB-F1336J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]
E-AB-F1336J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]
E-AB-F1336J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2364), CF647 conjugate, 0.1mg/mL
BNC472364-100 1x 100 µL

Calbindin 1 (CALB1) (CALB1/2364), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Amer2 Mouse Gene Knockout Kit (CRISPR)
KN501188 1 Kit

Amer2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Variable Volume 12 Channel Micropipette BPIP-313
BPIP-313 1 Unit

Variable Volume 12 Channel Micropipette BPIP-313

Sign In for Pricing
View Details