Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA4 Peptide - C-terminal region

SPATA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPEF1B, TSARG2

UniProt

Q8NEY3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA4 Rabbit Polyclonal Antibody (orb325386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653245

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Rel B/RELB Antibody Picoband® Fluoro550 Conjugated
PA1803-Fluoro550 100 µg/Vial

Anti-Rel B/RELB Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Human UNC5CL Knockout HEK293T cell line
GTR15408479 1 Vial

Human UNC5CL Knockout HEK293T cell line

Sign In for Pricing
View Details
C11orf52 CytoSection
TS411096P5 25 Slides

C11orf52 CytoSection

Sign In for Pricing
View Details
Recombinant Human Macrophage migration inhibitory factor/MIF Protein
RP02895LQ 50 µg

Recombinant Human Macrophage migration inhibitory factor/MIF Protein

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase 11 (STK11) ELISA Kit
orb1656789-01 48 Tests

Mouse Serine/threonine-protein kinase 11 (STK11) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase 11 (STK11) ELISA Kit
orb1656789-02 96 Tests

Mouse Serine/threonine-protein kinase 11 (STK11) ELISA Kit

Sign In for Pricing
View Details