Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA4 Peptide - C-terminal region

SPATA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPEF1B, TSARG2

UniProt

Q8NEY3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA4 Rabbit Polyclonal Antibody (orb325386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653245

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-22Ra Antibody (ARGX-112)
F1234-5 5 mg

Anti-IL-22Ra Antibody (ARGX-112)

Sign In for Pricing
View Details
LDHC Antibody
orb679252 100 µL

LDHC Antibody

Sign In for Pricing
View Details
FLI1 Antibody
orb2642003 100 µg

FLI1 Antibody

Sign In for Pricing
View Details
8-Hydroxyquinoline
C6471-100 100 mg

8-Hydroxyquinoline

Sign In for Pricing
View Details
HSPA5 Matched Antibody Pair Set [ABP-S-051817]
ABP-S-051817 5 Plates

HSPA5 Matched Antibody Pair Set [ABP-S-051817]

Sign In for Pricing
View Details
Rasgrp2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4816903 1.0 µg DNA

Rasgrp2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details