Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB2 Peptide - N-terminal region

HSPB2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSPB2

UniProt

Q16082

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPB2 Rabbit Polyclonal Antibody (orb580314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001532

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Milk Fat Globulin (MFG) (MaxLight 750) discontinued
M3897-08A-ML750 100 µL

Milk Fat Globulin (MFG) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Tert-butyl 3- (chlorosulfonyl) azetidine-1-carboxylate
JH920593 1 Each

Tert-butyl 3- (chlorosulfonyl) azetidine-1-carboxylate

Sign In for Pricing
View Details
Prss44 Protein Vector (Rat) (pPM-C-HA)
37860026 500 ng

Prss44 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse PRPF18 siRNA
abx929905-01 15 nmol

Mouse PRPF18 siRNA

Sign In for Pricing
View Details
Mouse PRPF18 siRNA
abx929905-02 30 nmol

Mouse PRPF18 siRNA

Sign In for Pricing
View Details
MFAP3 (Microfibrillar-associated Glycoprotein 3, DKFZp586F0219) (MaxLight 550)
129602-ML550 100 µL

MFAP3 (Microfibrillar-associated Glycoprotein 3, DKFZp586F0219) (MaxLight 550)

Sign In for Pricing
View Details